PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00055779001
Common NameGSBRNA2T00055779001, LOC106380208, LOC106380209
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 303aa    MW: 33936.6 Da    PI: 8.6587
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00055779001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.76.2e-393392261
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                          +++lkcprC+s+ntkfCyynnyslsqPr+fCk+CrryWt+GG+lrnvP+Ggg+rk kks
  GSBRNA2T00055779001 33 DQQTLKCPRCNSSNTKFCYYNNYSLSQPRHFCKSCRRYWTRGGSLRNVPIGGGCRKTKKS 92
                         57899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-342091IPR003851Zinc finger, Dof-type
PfamPF027014.6E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4783791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MSSHTNLHSP KPDHRITGAS HTKKPPSSTA SQDQQTLKCP RCNSSNTKFC YYNNYSLSQP  60
RHFCKSCRRY WTRGGSLRNV PIGGGCRKTK KSIKPSIVAP SSSSQRFFSS TMEEASKFFT  120
PPTAMDFQLA GLSLSKINDL QLMNNQEVLG LRTTMEQVET TPVDVGSGLT LMGFGDYNSN  180
NNHSPVTFTT DGNLATSIET LSCLNQDLHW RLQQQRMAMF FGNSKEETVV VERPQPLLYR  240
NLEIVNSSPS LTSKKGENQT EWYFGNNNDN ERVINNNENN NTGGSDQWNN GIQAWTDLNH  300
YN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00055779001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013675466.10.0PREDICTED: dof zinc finger protein DOF5.7-like
RefseqXP_013675468.10.0PREDICTED: dof zinc finger protein DOF5.7-like
SwissprotQ9LSL61e-167DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLA0A078HAS90.0A0A078HAS9_BRANA; BnaC02g43890D protein
STRINGBra031853.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49502850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-159Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]